Connecting...

W1siziisijiwmtgvmtevmdyvmtqvmtkvmdqvntayl1vudgl0bgvkigrlc2lnbi5wbmcixsxbinailcj0ahvtyiisijiwmdb4mzuwxhuwmdnjil1d

Channel K.C.

Kensington Consulting's Job of the Week - HR & HSE Manager, Manchester

Kensington Consulting's Job of the Week is an HR and HSE Manager based in Manchester working for an Aerospace component manufacturer

To read the full job description, click here.

Email: phillip.hodson@kensingtonconsulting.co.uk 
Phone: +44(0) 1257 268273.

Kensington Additive's Job of the Week - Applications Engineer, Germany

​​Kensington Additive's Job of the Week is an Applications Engineer, based in Germany working for a Metal Additive Manufacturing company. 

To read the full job description, click here.

Email: phillip.hodson@kensingtonconsulting.co.uk 
Phone: +44(0) 1257 268273.

Kensington Additive's Job of the Week - Electrical Engineer, Texas

​​Kensington Additive's Job of the Week is an Electrical Engineer, based in Texas working for an innovative and discruptive machine and materials provider in the additive manufacturing industry.

To read the full job description, click here.

Email: mark.ainscough@kensingtonconsulting.co.uk 
Phone: +44(0) 1257 268273.

Kensington Additive's Job of the Week - Territory Manager, Minnesota

Kensington Additive's Job of the Week is a Territory Manager, based in Minnesota working for an Additive Manufacturing reseller of major OEMs.

Watch the video to learn more or apply via our job advertisement here.

Email: mark.ainscough@kensingtonconsulting.co.uk 
Phone: +44(0) 1257 268273.

Kensington Additive's Job of the Week - Senior Controls Engineer (Texas or California)

Kensington Additive's Job of the Week is a Senior Controls Engineer working for a world-class materials and machine provider within the additive manufacturing industry.

Watch the video to learn more or apply via our job advertisement here.

Email: mark.ainscough@kensingtonconsulting.co.uk 
Phone: +44(0) 1257 268273.


Kensington Additive's Job of the Week - FSE Engineer, Munich


Kensington Additive's Job of the Week is a Field Service Engineer working for a well-established Metal  AM company based  in Munich.

The role requires up to 50% travel to customer sites.

Watch the video to learn more or apply via our job advertisement here.

Email: Phillip.Hodson@kensingtonconsulting.co.uk 
Phone: +44(0) 1257 268273.


Kensington Additive's Job of the Week - FSE Engineer, California


Kensington Additive's Job of the Week is a Field Service Engineer working for a well-established Metal AM company based at the customer site in California.

The role is on-site, so there will be no extra travel included.

Watch the video to learn more or apply via our job advertisement here.

Email: Phillip.Hodson@kensingtonconsulting.co.uk 
Phone: +44(0) 1257 268273.


Kensington Consulting's Job of the Week - Sales / Business Development Manager, East Lancashire



Kensington Consulting's Job of the Week is a Sales/ Business Development Manager within the aersoapace industry based in East Lancashire.

The role is offering home working and the earning potential of up to £90k per annum,

Watch the video to learn more or apply via our job advertisement here.

Email: Phillip.Hodson@kensingtonconsulting.co.uk 
Phone: +44(0) 1257 268273.

Kensington Consulting's Job of the Week - Technical Coordinator, Paris & Tours


Kensington Consulting's Job of the Week is a Technical Coordinator within the nuclear industry based in Paris and another vacancy in Tours, France. You will work as a coordinator between your employer and the customer, assisting with projects and offering solutions. 

Watch the video to learn more or, speak to Phillip Hodson about the full details.

Email: Phillip.Hodson@kensingtonconsulting.co.uk 
Phone: +44(0) 1257 268273.To

Kensington Additive's Job of the Week - Channel Manager, West Coast


Kensington Additive's Job of the Week is a Channel Manager based on the West Coast, USA. In this role you will liaise between the company's European headquarters and your given territory, driving sales and generating new business.

Watch the video to learn more... or, speak to Liam Atkinson about the full details and how to apply, at liam.atkinson@kensingtonconsulting.co.uk / +44(0) 1257 268273.To l


Kensington Additive's Job of the Week - Head of AM, Berlin


K

Our Job of the Week is a Head of Additive Manufacturing, based in Berlin. You'll be overseeing the AM department, so knowledge of AM's full process, from rapid prototyping, testing through to commercialization, will be a must.

To learn more about this candidate watch the video.

Or... speak to Liam Atkinson at liam.atkinson@kensingtonconsulting.co.uk / +44 (0) 1257 268273.

Kensington Additive's Candidate of the Week - R&D Engineer



Our Candidate of the Week is a modestly titled R&D Engineer, who is based in Bavaria and has 7 years of experience in technical roles and AM.

To learn more about this candidate watch the video.

Or... speak to Liam Atkinson at liam.atkinson@kensingtonconsulting.co.uk / +44 (0) 1257 268273.

Kensington Consulting's Job of the Week - HSEQ



Kensington Consulting's Job of the Week is a HSEQ based in Hinckley. If you are looking for a role that is offering stability then this could peak your interest...

Want to apply or learn more?

Speak to James Field at james.field@kensingtonconsulting.co.uk or call on +44 (0)1257 268273.

Kensington Additive's Job of the Week - Area Sales Manager



Our Job of the Week is an Area Sales Manager role based in the Netherlands. Looking after the EMEA region, you will be involved in developing and defining sales strategies, as well as organising exhibitions, workshops and events for customers.

Want to apply?

Contact: Liam Atkinson at liam.atkinson@kensingtonconsulting.co.uk or call on +44 (0)1257 244 442.

Kensington Additive's Candidate of the Week - Director of Strategy & Marketing, Germany

Our Candidate of the Week is a Director of Strategy & Marketing based in Germany. They work within an AM department and are extremely customer-focused.

Want to learn more?

Contact: Michelle Bond at michelle.bond@kensingtonconsulting.co.uk or call on +44 (0)1257 244 442.

Kensington Additive's Job of the Week - Materials Product Manager, Northern Germany

Our Job of the Week is a Material Product Manager role based in Northern Germany, working for an Additive Manufacturing company. You will need a strong technical background with materials as well as having an understanding of the 3D printing process. 

Want to apply?

ContactLiam Atkinson at liam.atkinson@kensingtonconsulting.co.uk or call on +44 (0)1257 244 442.

Kensington Additive's Candidate of the Week - Applications Engineer, Southern France 

Our Candidate of the Week is an Application Engineer based in Southern France. They have experience within Additive Manufacturing, including Laser Powder Bed Fusion and Direct Energy Deposition. Watch the video to learn more.

Want to learn more?

ContactMichelle Bond at michelle.bond@kensingtonconsulting.co.uk or call on +44 (0)1257 244 442.

Kensington Consulting's Job of the Week - Application Development Food & Beverage Manager, New Jersey


Our Job of the Week is an Application Development Food and Beverage Manager working in New Jersey working for a Technology and Applications leading company. This role offers an attractive salary package with a 20% bonus and healthcare. Watch the video to learn more.

Want to apply?

Contact: Liam Atkinson at liam.atkinson@kensingtonconsulting.co.uk or call on +44 (0)1257 244 442.

Kensington Additive's Candidate of the Week - Senior Sales Director, France

Kensington Additive's Candidate of the Week is a Senior Sales Director, based in France. This person has extensive experience within the digital transformation domain.

Watch the video to learn more.

Contact: Liam Atkinson at liam.atkinson@kensingtonconsulting.co.uk or call on +44 (0)1257 244 442.

Kensington Additive's Job of the Week - Senior Software Engineer, Massachusetts 

Kensington Additive's Job of the Week is a Senior Software Engineer, based in Massachusetts. The company is working within the metal additive manufacturing industry and they are looking for someone to take on the responsibility of defining and executing critical milestones in the lifecycle of the software suite.

Want to apply?

Contact: Rebecca Hamilton at rebecca.hamilton@kensingtonconsulting.co.uk or call on +44 (0)1257 244 442.

Kensington Additive's Candidate of the Week - Senior Software Engineer, California



Kensington Additive's Candidate of the Week is a Senior Software Engineer, based in California. This person has 15 years of industry experience and a long-list of achievements.

Watch the video to learn more.

Contact: Rebecca Hamilton at rebecca.hamilton@kensingtonconsulting.co.uk or call on +44 (0)1257 244 442.


Kensington Additive's Job of the Week - Director of Software Development


Kensington Additive's Job of the Week is a Director of Software Development, which has the potential to be based in either of two locations; Austin, Texas or Irvine, California. This role has Senior Management responsibility for the company's software strategy and development.

Watch the video to learn more.

Want to apply?

Contact: Mark Ainscough at mark.ainscough@kensingtonconsulting.co.uk or call on +44 (0)1257 244 743..

Kensington Additive's Candidate of the Week - CFD Engineer, Michigan



Kensington Additive's Candidate of the Week is a CFD Engineer, based in Michigan. This person has 5 years of research and industrial experience and is familiar with design, meshing, post-processing, and programming software packages.

Watch the video to learn more.

Contact: Rebecca Hamilton at rebecca.hamilton@kensingtonconsulting.co.uk or call on +44 (0)1257 244 442.


Kensington Additive's Job of the Week - Quality Manager & Regulatory Affairs, Germany 



Kensington Additive's Job of the Week is a QM&RA role, based in Germany. The key requirements of this role include the registration of dental medical devices across the EU, U/.S. and Canada.

Watch the video to learn more.

Want to apply?

Contact: Liam Atkinson at liam.atkinson@kensingtonconsulting.co.uk or Michelle Bond at michelle.bond@kensingtonconsulting.co.uk or call on +44 (0)1257 268273.


Kensington Additive's Candidate of the Week - Software Product Manager, Massachusetts

 

Kensington Additive's Candidate of the Week is a Software Product Manager, based in Massachusetts. This person has over 7 years of experience within the industry and has led several teams to bring 2 3d printing applications to the market.

Watch the video to learn more.

Contact: Rebecca Hamilton at rebecca.hamilton@kensingtonconsulting.co.uk or call on +44 (0)1257 244 442.

Kensington Additive's Job of the Week - Machine Learning Engineer, LA


Kensington Additive's Job of the Week is a Machine Learning Engineer Engineer, based in Los Angeles. This person will need to have an interest in Soccer...

Watch the video to learn more.

Want to apply?

Contact: Mark Ainscough at mark.ainscough@kensingtonconsulting.co.uk or call on +44 (0)1257 244743.


Kensington Additive's Job of the Week - Senior Controls Engineer, Boston

Kensington Consulting's Job of the Week is a Senior Controls Engineer, based in Boston. This person will be developing motion controls for novel multi-axis.

Watch the video to learn more.

Want to apply?

Contact: Mark Ainscough at mark.ainscough@kensingtonconsulting.co.uk or call on +44 (0)1257 244743.

Kensington Additive's Candidate of the Week - Technical Director, Germany


Kensington Additive's Candidate of the Week is a Technical Director based in Germany. This person leads the R&D and AM Production Line as well as designing and building new production facilities. 

Watch the video to learn more.

Contact: Michelle Bond at michelle.bond@kensingtonconsulting.co.uk or call on +44 (0)1257 244749

Kensington Consulting's Job of the Week - Lead Turbine Engineer, San Francisco


Kensington Consulting's Job of the Week is a Lead Turbine Engineer, based in San Francisco. This person will be providing technical leadership in the continued development of the turbine engine.

Watch the video to learn more.

Want to apply?

Contact: Tom Barnes at tom.barnes@kensingtonconsulting.co.uk or call on +44 (0)1257 268 440

Kensington Additive's Job of the Week - Vice President of Operations, Hungary


Kensington Additive's Job of the Week is a Vice President of Operations based in Hungary, working for an AM company. This person will be responsible for purchasing, manufacturing, managing consumables, cost control, and quality.

Watch the video to learn more.

Want to apply?

Contact: Michelle Bond at michelle.bond@kensingtonconsulting.co.uk or call on +44 (0)1257 244749

Kensington Additive's Candidate of the Week - VP of AM, North Carolina


A Technical Leader with 20 years' experience in Metal AM, is looking for new opportunities. In their last company, they progressed from Head of Engineering and Technology to Head of R&D to VP of AM. 

Watch the video to learn more.

Contact: Phillip Hodson at phillip.hodson@kensingtonconsulting.co.uk or call on +44 (0)1257 268273.

Kensington Additive's Job of the Week - Senior Mechanical Engineer, California


A supplier of metal 3d printers in California is looking for a Senior Mechanical/Mechatronics Engineer to join their team. 

Watch the video to learn more.

Want to apply?

Contact: Phillip Hodson at phillip.hodson@kensingtonconsulting.co.uk or call on +44 (0)1257 268273

Kensington Additive's Candidate of the Week - Sales Director


Are you looking for an experienced Sales Director to join your team and hit the ground running? This week's candidate is used to achieving and often over-achieving their targets, as well as directing and enhancing the skills of their staff. 

Watch the video to learn more.

Contact: Anu Nambiar at anu.nambiar@kensingtonconsulting.co.uk or call on +44 (0)1257 244740

Kensington Additive's Job of the Week - Applications Engineer 


A 3D Measurement company based in the West Midlands is looking for an Applications Engineer to join their team and get involved in some of their bespoke projects with high profile clients.

Watch the video to learn more.

Want to apply?

Contact: Anu Nambiar at anu.nambiar@kensingtonconsulting.co.uk or call on +44 (0)1257 244740.

Kensington Additive's Candidate of the Week - Business Development Manager


Our candidate of the week is a Business Development Manager, based in Hamburg, Germany. This person has 16 years' experience within Aerospace, Automotive, IT and AM. They are immediately available. 

Watch the video to learn more.

Contact: Michelle Bond at michelle.bond@kensingtonconsulting.co.uk or call on +44 (0)1257 244749.


Kensington Additive's Job of the Week - Area Sales Manager



This week, a Netherlands based company is searching for an Area Sales Manager, who has a minimum of 5 years' sales and AM experience. You will be expected to travel between 20-40% of the time, on an international level. 

Watch the video to learn more.

Want to apply?

Contact: Liam Atkinson at liam.atkinson@kensingtonconsulting.co.uk or call on +44 (0)1257 268273.

Kensington Additive's Job of the Week - Applications Engineer


Kensington Additive's job of the week is an Applications Engineer based in Berlin, Germany. The company is looking for someone with up to 3 years' experience in AM. 

Key responsibilities:

Providing technical support to existing customers, including troubleshooting, installations, maintenance, and repairs. Travel up tp0 60% across Europe. 

Want to apply?

Contact: Michelle Bond at michelle.bond@kensingtonconsulting.co.uk or call on +44 (0) 1257 244 749 to learn more.

Kensington Additive's Candidate of the Week - Sales Manager


Kensington Additive's candidate of the week is a Sales Manager based in Worcestershire. They have 28 years' experience, mainly within the Automotive industry and are looking for a new challenge. They have experience with Additive Manufacturing, as well as CNC Machines and Laser Cutting Machinery. 

Interested to see a profile?

Contact: Rebecca Hamilton at rebecca.hamilton@kensingtonconsulting.co.uk or call on +44 (0) 1257 244 742 to learn more.

Kensington Additive's Job of the Week - Technical Consultant


Are you looking for a home-based role, where you can travel to customers and share your knowledge of all things Autodesk? A UK based, Additive Manufacturing software reseller is looking for someone to join their team and are offering car allowance, a laptop and health benefits.

Contact: Liam Atkinson at liam.atkinson@kensingtonconsulting.co.uk or call on +44 (0) 1257 268273 to learn more.

Kensington Consulting's Candidate of the Week - Applications Engineer


With 20 years of experience in Automotive, working for one of the biggest names in the industry, this candidate has worn a multitude of hats. Having worked as a Project Lead in the past, they are now an Applications Engineer engaging in site visits to customers, installing hardware and software and much more. 

Contact: Rebecca Hamilton at rebecca.hamilton@kensingtonconsulting.co.uk or call on +44 (0) 1257 244742. 

Kensington Additive's Job of the Week - Financial Controller


This week's Job of the Week is for a Financial Controller position, for an Additive Manufacturing company based in Sheffield. If you're interested in finding out more about this vacancy, then contact James on +44 (0) 1257 268 273. 

Kensington Additive's Candidate of the Week - Experienced Commercial Candidate


This week's candidate is an experienced commercial candidate. If you're interested in finding out more about this candidate, contact Michelle on +44 (0) 1257 268 273. 


Kensington Consulting's Job of the Week - Mechanical Designer


Kensington Consulting's Job of the Week is a Mechanical Designer contract position located in Northern Scotland. If you'd like more information on this position contact matthew.smethurst@kensingtonconsulting.co.uk


Kensington Additive's Job of the Week - Senior Software Engineer


Kensington Additive's Job of the Week is a Senior Software Engineer located in California. If you'd like to learn more about this job email matthew.smethurst@kensingtonconsulting.co.uk


Kensington Consulting's Candidate of the Week - Experienced Quality Manager


Kensington Consulting's Candidate of the Week is an experienced Quality Manager located in Greater Manchester, if you'd like to learn more about this candidate, contact James Field on +44 (0) 1257 268 273.


Kensington Additive's Candidate of the Week - Established Sales Director


Kensington Additive's Candidate of the Week is an established Sales Director. Experienced in the Aerospace, Electrical/Automation and Additive Manufacturing industries. This candidate significant experience working in high profile, fast paced commercial & managerial roles, working from board level down. If you'd like to learn more about this candidate, contact us by clicking here.


Kensington Consulting's Job of the Week - Manufacturing Process Engineer


This week's Job of the Week is a Manufacturing Process Engineer, the job is located in Bolton with a salary of £40k. For more information on this role, click here. 


Kensington Additive's Candidate of the Week - Experienced Software Technology Executive


Kensington Additive would like to introduce this exclusive candidate. He is an experienced software technology executive, specialised in engineering, manufacturing and enterprise software, with 25 years international product management, sales, and marketing experience. If you're interested in seeing this candidate's full resume or two-way video interview, you can contact Phillip Hodson by clicking here.

Kensington Consulting - Video Testimonial recevied from Emerson Automation Solutions


Following our work with Emerson Automation Solutions, we received a video testimonial from Ashleigh Maddison, Emerson Automation Solutions. To read more about our work with Emersons, click here.


Additive Manufacturing is a Platform for Female Empowerment - A Discussion with Eliana Fu.


Kensington Additive's Hannah Treston talks with Relativity Space's Eliana Fu regarding additive manufacturing being a platform for female empowerment. 


Kensington Additive News - Episode 14 - 14/06/2019

 

Pharmaceutics Professor Mandip Sachdeva from the Florida A&M University (FAMU) has led a research project to 3D print a cornea in what is reportedly the first example of high throughput printing of human cells, particularly in America, read more. 

HP has opened a 150,000 square-foot centre of excellence for 3D printing and digital manufacturing in Barcelona.

The new facility has been established to enable collaboration between vendor, customers, and partners in a factory-like environment, actioning further research and development around the company's portfolio of additive manufacturing technologies, read more. 

At NASA's John C. Stennis Space Centre, nestled in Hancock County, Mississippi, right on the border of Louisiana. Relativity Space, is planning a $59 million expansion to make a permanent manufacturing hub, watch this video for more information. 

The 3D Printer Manufacturer and cermaic studio based in Florida, 3D Potter, has just unveiled their newest compact size clay 3D printer - the Scara Mini V1. The company already supplies its real clay 3D printers to over 200 universities, art galleries and it is the preferred printer at a large US-based chocolatier, read more. 


Kensington Additive News - Episode 13 - 31/05/2019


True Shape Nesting is an advanced feature inside Link3D’s Build Simulation software. This software platform is used for auto-quoting, production planning, and machine scheduling within additive manufacturing workflows, and estimates production time and material usage based on data retrieved from hundreds of 3D printing systems, read more. ​

At this year’s Rapid + TCT additive manufacturing event in Detroit, BigRep, the large-scale 3D printer manufacturer, will present new products and prototypes including a new generation large-format 3D printer for industrial applications. The STUDIO G2 is a second generation, upgraded printer based on BigRep’s STUDIO platform. Making this new addition apart from its predecessor is its ability to print using engineering-grade materials, read more.  

Oerlikon, inaugurated its Innovation Hub & Advanced Component Production facility in Huntersville as part of its ongoing US growth strategy. The facility will serve as a cornerstone of Oerlikon’s additive manufacturing business in the US, read more. 

Continental is known for manufacturing automotive components ranging from brake systems, interiors and perhaps most famously – tyres. The new centre, led by Continental Engineering Services, will enable, “the high-precision and efficient production of small quantities of components for internal and external customers.” Read more.


Kensington Additive's experience at Rapid + TCT 2019


Kensington Additive attended Rapid + TCT 2019 in Detroit, in this video Hannah Treston answers questions regarding the event.


Kensington Additive News - Episode 12 - 16/05/2019


Chuck Sullivan and Jack Fitzpatrick, interns at NASA’s Langley Research Centre in Hampton, Virginia, are investigating the viability of using soft robotics for space exploration and assembly. Soft robots are constructed from highly flexible materials, allowing for new robot movements similar to living organisms that traditional robots can’t replicate, therefore presenting new possible applications for robots in space, read more.

London-based 3D printing service bureau Batch.works has unveiled its first full homeware collection developed using 3D printing. With pieces designed in partnership with studios UAU and Bold Design the collection was 3D printed using FDM technology at Batch.works’ east London headquarters, read more.

Voxeljet, a leading manufacturer of sand and polymer binder jetting industrial 3D printers, is officially opening its new 78,000 square foot voxeljet Asia facility in Suzhou, nearby Shanghai (China) on Thursday, May 16th, exactly two years after the first stone was set. The cutting edge additive manufacturing hub will have more than 400 tons of annual 3D printing capacity, read more.

HP and Siemens announces an expansion of their strategic alliance to help customers transform their businesses with industrial additive manufacturing.

Siemens, an innovation leader in automation and digitalisation, and HP, the leader in industrial 3D printing, will expand their integrated additive manufacturing solution, incorporating new systems and software innovations including overall product lifecycle management, AM factory optimisation, industrial 3D printing and data intelligence, manufacturing execution, and performance analytics, read more.


Kensington Additive News - Episode 11 - 02/05/2019

Zero Barrier, a Wisconsin-based start-up, is working on building a 3D printer that it claims will make metal 3D printing faster and cheaper. Currently, 3D printing is one of the most expensive methods to make metal parts. Most metal 3D printers are high-cost laser-based systems which use special metal powders, read more. 

To help protect NASA's Space Launch System and Orion Spacecraft, technicians and engineers are using 3D printed part molds to ensure ideal thermal protection on smaller components and hardware. Traditionally, spray-on foam or another type of insulation is applied to parts of all sizes to protect the rocket from the heat generated during launch. This insulation also helps to keep propellant cool so it doesn't combust, read more.

Axial3D announces webinar which will focus on the impact of 3D printing within the medical industry, aiming to educate those within the industry alongside the general public. The webinar will last approximately 45 minutes and will be hosted by Nigel McAlpine, immersive technology lead at Digital Catapult NI, read more.

Progressive Technology Ltd, Newbury, Berkshire, UK, a company specialising in CNC multi-axis machining, is using advanced modern machinery and additive manufacturing to manufacture complex metallic components, primarily for the Formula One (F1) market, read more.


Kensington Additive Meets Relativity Space

Our very own Hannah Treston had the chance to talk to Relativity Space's Eliana Fu. Eliana is the Senior Raw Materials Supply Chain Engineer at Relaitivty Space. Hannah and Eliana spoke about how great of a tool Additive Manufacturing is, what differentiates Relativity Space from the rest of the market and much more.


Kensington Additive News - Episode 10 - 18/04/2019


Advanced Manufacturing (AM) is becoming increasingly important in the highly competitive aerospace market - and two leaders in the AM field, 3M and GF Machining Solutions, have developed a new technology that empowers manufacturers to implement AM in their workflows with faster rates and higher quality. Read more.

Researchers at the German Aerospace Centre (DLR) have developed a reusable rocket engine specifically for the launch of small satellites. The complex injector heads are 3D printed which unlocks additional performance, reduces the part count, speeds up production time, and reduces weight and costs. Read more.

3D Systems has announced the opening of a new Advanced Additive Manufacturing Centre in Pinerolo, Italy. The new centre was established to broaden the company's On Demand manufacturing service in Europe, beyond sites already, present in France, the UK, and Germany, among others. Aiming to double its manufacturing capacity and meet customer demand, the move is part of an ongoing "multimllion dollar expansion." Read more.

Scientists at the University of Minnesota have produced a 3D printed transparent skull implant for them to observe the inner workings of mouse-brains in real time. Named the See-Shell it could provide new insights for human brain conditions such as Alzheimer's and Parkinson's disease. Read more.

Kensington Additive - Ellé Rossall interview with Nora Toure 


This week our very own Ellé Rossall had the pleasure of interviewing Nora Toure. In the interview Ellé spoke with Nora regarding her experiences in the Additive Manufacturing industry, and the drivers behind her starting the 'Women in 3D Printing' movement. 


Kensington Additive News - Episode 9 - 05/04/19


Sciaky, Inc., a Chicago- based provider of metal 3D printing solutions, has entered into an agreement with KTM Consultants, headquartered in Sydney, to expand its Electron Beam Additive Manufacturing (EBAM) technology across Australia, New Zealand, and the Middle East, read more.

America Makes and The TCT Group have today announced a partnership that will see the two organisations collaborate to promote 3D Printing and Additive Manufacturing technologies, tackle their challenges and ultimately accelerate adoption on a global scale, read more.

Fast Radius, an industrial-grade contract manufacturer specialising in additive manufacturing, has raised $48 million in Series B financing, with the round led by UPS alongside insider particpation from Drive Capital. Fast Radius has stated that the funding will be channelled towards accelerating with expansion of its software platform, identifying and launching additive applications, and scaling up its additive manufacturing capacity, read more.

Cleveland-based Lincoln Electric Holdings Inc. has acquired Baker Industries Inc., a privately held provider of custom tooling, parts, and fixtures for the automotive and aerospace markets, based in Detroit. Baker's in-house design and manufacturing capabilities include machining, fabricating, assembly, and additive manufacturing (AM). Its operations are AS9100D-certified and Nadcap-accredited.

The Baker organisation will complement Lincoln Electric's automation portfolio and its new metal AM service business that will launch in mid-2019. The new metal AM business will manufacture large-scale printed metal parts, prototypes, and tooling for industrial and aerospace customers, read more.

Kensington Additive News - Episode 8 - 25/01/19


The Dutch manufacturer of printers, Tractus3D announces the technical specifications and pricing for their new PEEK 3D Printer, the T850P. It's the newest FFF system, designed for high-performance materials such as Carbon PEEK and PEI and boasts a heating chamber, that can reach temperatures of up to 65°C, read more

Desktop Metal close a record-breaking $160 million in funding from Koch Disruptive  Technologies, the venture capital and private equity firm who have revenues over $110 billion and headed by Chase Koch of the famous financier dynasty, read more

The first-ever full-size, 3D printed concept car that is paying tribute to the late David Bowie will be showcased at the Festival Automobile International in Paris at the end of the month. Massivit 3D Printing Technologies have partnered up with Marie 3D and designer Takumi Yamamoto, read more

Renishaw has announced the opening of two brand new solution's centres in Europe, based in Barcelona, Spain and Torino, Italy. The centres will have local additive manufacturing specialists who will work closely with customers to aid with engineering projects, read more

The largest 3D printed concrete bridge has been completed in the Baoshan district of Shanghai. The bridge spans 26.3 metres and is 3.6 metres wide, with the design being influenced by the ancient Anju bridge, read more 

Jabil has announced their new business 'Engineered Materials', which will be a separate business unit. The company will work to deliver customised and specialised polymer additive manufacturing materials to the market, read more


Kensington Additive News - Episode 7 - 11/01/19

Aubert & Duval, metallurgy specialist and leading high performance steels, titanium and aluminium company have now partnered with plasma manufacturing expert, PyroGenesis. Aubert & Duval will now exclusively distribute PyroGenesis' titanium powders within the European market, read more.

Metal additive manufacturing technology company, Velo3D have now partnered with Conneticut's Praxair Surface Technologies, Inc., in order to qualify and develop process parameters for their materials, read more.

Preston-based company, Lancashire 3D have now opened their first facility where they will produce prototypes and end-use components using material extrusion and VAT photopolymerisation processes. The company hosts 35 machines, which they can use for 3D printing capacity to fulfil prototyping requests, read more. 

XYZ Printing, 3D printer manufacturer based in Taiwan, revealed their range of new 3D printing products at CES 2019. This included their Da Vinci Color Mini 3D printer for low cost, full-colour 3D printing, in addition to a number of new materials, read more.

Formlabs have released their new 3D printing resins at CES 2019. The elastic resin is Formlabs' softest engineering resin, with a 50A shore durometer. This is designed for the prototyping of silicone parts which need to bend, stretch, compress and withstand repeated cycling without being able to tear, read more.

The US aeronautical company, Boeing has released images of their upcoming 777x twin-engine jet. The aircraft includes six 3D printed parts inside its GE9X engines, and is set to be the largest plane of its kind in the world. Temperature sensors, fuel mixers and heat exchangers are all 3D printed, read more.

Kensington Additive News - Episode 6 - 14/12/18

MakerBot have introduced their latest machine with 3D industrial 3D printing capabilities which they call the 'Method'. The aim with this machine is to bridge the gap between desktop and industrial 3D printing and is designed to match precision, reliability, and dimensional accuracy, read more.

ExOne have released its latest system, the X1 25 Pro. They introduced the system to enable larger build volume, and the equivalent powder metallurgy capabilities from another system of theirs, INNOVENT+. The platform is designed to focus on the Metal Injection Moulding, powder metallurgy, and mechanical engineering markets, read more.

Markforged have announced the launch of the H13 tool steel for its metal additive manufacturing platform, which they named the Metal X. The H13 is renowned for exhibiting excellent red hardness, resistance to thermal fatigue, ductility, toughness and good abrasion resistance, read more.

Volkswagen have opened a new advanced 3D printing centre, located in the manufacturer's home, Germany. The facility holds 3,100m squared of floor space, and houses a range of cutting edge metal additive manufacturing machines, read more.

Siemens have revealed their £27 million investment in a new, state of the art manufacturing facility for their additive manufacturing department in the UK. Worcester-based business, Materials Solutions Ltd will open the new site in September 2018, which will enable them to increase AM machines from 15 to 50 over the next five years, read more.

GKN Aerospace are opening their Global Technology Centre which will focus on additive manufacturing, advanced composites, assembly and Industry 4.0. The centre is set to open in Bristol in 2020, and is said to be worth £32m and will house 300 engineers, read more.

Kensington Additive News - Episode 5 - 30/11/18

Etihad Airways Engineering have announced their new and extended partnership with leading additive manufacturing companies, EOS and BigRepOne. This is because the company look to enhance their maintenance, overhaul and repair (MRO) services, read more.

Adidas have launched their latest 3D printed sneaker, which they call the ALPHAEDGE 4D. Using the uniquely engineered Adidas 4D midsole, for a more controlled energy return and breathable cushioning, for intense training purposes, read more.

Arburg have recently released their Freeformer 300-3X. The machine additive manufactures three-component parts in both hard and soft combinations. The company said it is the first time that additive manufacturing can make complex, functional hard/soft parts using support structures, read more.

STS Additive Manufacturing announced an investment in Markforged's Metal X 3D printing system. The AM service provider purchased the machine through BigSystems, a Markeforged reseller, becoming one of the first companies in the US to have installed the Metal X, read more.

3D Fab are now developing a "living bandage" using 3D bioprinting and direct additive manufacturing. According to the platform's project "STRESSKIN", such technologies can be positioned in the field of regenerative and personalised medicine to address current issues, read more.

GE Healthcare and VA Puget Sound Health Care System revealed their partnership to deliver improved precision healthcare for U.S. veterans, using advanced 3D imaging technology. Building on their 3D printing network, VA Puget Sound are integrating GE Healthcare's visualisation AW VolumeShare workstation with 3D printing software, read more.

Kensington Additive News - Episode 4 - 16/11/18

GE Additive has announced when they will be delivering their Concept Laser M Line Factory systems - Q2 of 2019. Previously announced at Formnext 2016, the modular system is supplemented by automation in order to deliver a reliable series production tool, read more.

Stratasys offered insight into it's new platform which is currently being developed and designed for short-run metal applications. First unveiled earlier this year, the platform is based on Stratasys' Layered Powder Metallurgy technology, read more.

HP has announced a series of developments regarding customers, applications and partnerships at Formnext 2018. This included their partnership with Autodesk, as they will use the software company's Generative Design tools to Multi Jet Fusion users, read more.

FDM Digital solutions and Roboze are now working together thanks to the Xtreme3DParts project, with the vision of transforming traditional manufacturing within aerospace, F1, automotive and industrial sectors, through high performance 3D printing technologies and materials, read more.

At Formnext, Desktop Metal discussed a number of advancements and expansion of capabilities to its Production System. They say the system is more than four times faster than any binder jet competitor, and 100 times faster than current laser-based systems, read more.

Global specialty polymer company, Solvay, has introduced three medical grade filaments for industrial additive manufacturing. This was done with the aim to broaden their portfolio of high-performance materials. The filaments can be used for a range of healthcare applications such as patient-specific cutting guides for surgery, read more.

Kensington Additive News - Episode 3 - 02/11/18

Additive Manufacturing technology developer, EOS North America, has completed its $2million investment in the North American market, in order to boost its additive manufacturing development, read more.

UK software company, Valuechain has received £960k funding from UK research & innovation towards the development of artificial intelligence into its additive manufacturing production control software, DNAam, read more.

PostProcess Technologies has announced the first step in its global expansion with the opening of its first international office and product launch in Europe, read more.

3YOURMIND have announced that they will be demonstrating an updated version of Additive Manufacturing Part Identifier System at formnext, read more.

Apium Additive Technologies has revealed the addition of a polypropylene material to its additive manufacturing portfolio ahead of their appearance at Formnext. They are set to make further announcements during the event, read more.

Kensington Additive News - Episode 2 - 15/10/18

Xjet opens Additive Manufacturing centre, and give detail on nanoparticle jetting and 3D printing. With an interview from CEO Hanan Gothait, read more.

Purdue University have found new 3D-printed cement paste gets stronger when it cracks — just like structures in nature, read more.

3D Systems have released the ProJet MJP 2500 IC, which is a wax 3D printer specifically for investment casting, read more.

Digital Metal unveils automation concept for metal 3D printing also known as a 'no-hand' production concept, read more.

Solukon teams with Siemens to launch smart metal 3D printing post processing system, read more.

Kensington Additive News - Episode 1 - 28/09/18

In our first episode of Kensington Additive news, we discuss what we learnt at The TCT Show 2018, followed by a video walk-through. More information can be found at www.tctmagazine.com  

Form ID:1478


Kensington Consulting's Job of the Week - HSEQ, Hinckley